Lineage for d1l1ob_ (1l1o B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463510Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
    barrel, closed; n=5, S=10
  6. 463565Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 463566Species Human (Homo sapiens) [TaxId:9606] [50270] (2 PDB entries)
  8. 463569Domain d1l1ob_: 1l1o B: [73479]
    Other proteins in same PDB: d1l1oa_, d1l1oc_, d1l1od_, d1l1of_

Details for d1l1ob_

PDB Entry: 1l1o (more details), 2.8 Å

PDB Description: Structure of the human Replication Protein A (RPA) trimerization core

SCOP Domain Sequences for d1l1ob_:

Sequence, based on SEQRES records: (download)

>d1l1ob_ b.40.4.3 (B:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens)}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi
nahmvlsk

Sequence, based on observed residues (ATOM records): (download)

>d1l1ob_ b.40.4.3 (B:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens)}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtdntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmv
lsk

SCOP Domain Coordinates for d1l1ob_:

Click to download the PDB-style file with coordinates for d1l1ob_.
(The format of our PDB-style files is described here.)

Timeline for d1l1ob_: