SCOP 1.71: Domain d1l1oa_: 1l1o A:

Lineage for d1l1oa_ (1l1o A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
   barrel, closed; n=5, S=10

6. Protein Replication protein A 14 KDa (RPA14) subunit [50271] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50272] (2 PDB entries)

8. Domain d1l1oa_: 1l1o A: [73478]
   Other proteins in same PDB: d1l1ob_, d1l1oc_, d1l1oe_, d1l1of_

Details for d1l1oa_

PDB Entry: 1l1o, 2.8 Å

PDB Description: Structure of the human Replication Protein A (RPA) trimerization core

SCOP Domain Sequences for d1l1oa_:

Sequence; same for both SEQRES and ATOM records:

>d1l1oa_ b.40.4.3 (A:) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens)}
dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi

Timeline for d1l1oa_:

• d1l1oa_ first appeared in SCOP 1.61
  
• d1l1oa_ appears in SCOP 1.69
  
• d1l1oa_ appears in SCOP 1.73
  
• d1l1oa_ appears in the current release, SCOPe 2.08