Lineage for d1l1la_ (1l1l A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097854Family c.7.1.4: B12-dependent (class II) ribonucleotide reductase [75131] (1 protein)
  6. 2097855Protein B12-dependent (class II) ribonucleotide reductase [75132] (1 species)
  7. 2097856Species Lactobacillus leichmannii [TaxId:28039] [75133] (1 PDB entry)
  8. 2097857Domain d1l1la_: 1l1l A: [73470]

Details for d1l1la_

PDB Entry: 1l1l (more details), 1.75 Å

PDB Description: crystal structure of b-12 dependent (class ii) ribonucleotide reductase
PDB Compounds: (A:) ribonucleoside triphosphate reductase

SCOPe Domain Sequences for d1l1la_:

Sequence, based on SEQRES records: (download)

>d1l1la_ c.7.1.4 (A:) B12-dependent (class II) ribonucleotide reductase {Lactobacillus leichmannii [TaxId: 28039]}
eislsaefidrvkasvkphwgklgwvtykrtyarwlpekgrsenwdetvkrvvegninld
prlqdspslelkqslteeaerlykliyglgatpsgrnlwisgtdyqrrtgdslnncwfva
irpqkygdskivpsylgkqekavsmpfsflfdelmkgggvgfsvarsnisqiprvdfaid
lqlvvdetsesydasvkvgavgknelvqdadsiyyrlpdtregwvlanallidlhfaqtn
pdrkqklildlsdirpygaeihgfggtasgpmplismlldvnevlnnkaggrltavdaad
icnligkavvagnvrrsaelalgsnddqdfismkqdqeklmhhrwasnnsvavdsafsgy
qpiaagirengepgivnldlsknygrivdgyqagidgdvegtnpcgeislangepcnlfe
vfpliaeeqgwdlqevfalaaryakrvtfspydweisreiiqknrrigismsgiqdwllt
rlgnrvvtgfkddfdpetheaikvpvydkraikmvdqlykavvkadqdysktlgcnesik
httvkpsgtvaklagasegmhfhygayliqrirfqdsdpllpalkacgyrteadiytent
tcvefpikavgadnpnfasagtvsiaeqfatqaflqtywsdnavsctitfqdsegdqves
llrqyrfitkstsllpyfggslqqapkepidketyekrsqeitgnveevfsqlnsdvkdl
e

Sequence, based on observed residues (ATOM records): (download)

>d1l1la_ c.7.1.4 (A:) B12-dependent (class II) ribonucleotide reductase {Lactobacillus leichmannii [TaxId: 28039]}
eislsaefidrvkasvkphwgklgwvtykrtyarwlpekgrsenwdetvkrvvegninld
prlqdspslelkqslteeaerlykliyglgatpsgrnlwisgtdyqrrtgdslnncwfva
irpqkygdskivpsylgkqekavsmpfsflfdelmkgggvgfsvarsnisqiprvdfaid
lqlvvdetsesydasvkvgavgknelvqdadsiyyrlpdtregwvlanallidlhfaqtn
pdrkqklildlsdirpygaeihgfggtasgpmplismlldvnevlnnkaggrltavdaad
icnligkavvagnaelalgsnddqdfismkqdqeklmhhrwasnnsvavdsafsgyqpia
agirengepgivnldlsknygrivdgyqagidgdvegtnpcgeislangepcnlfevfpl
iaeeqgwdlqevfalaaryakrvtfspydweisreiiqknrrigismsgiqdwlltrlgn
rvvtgfkddfdpetheaikvpvydkraikmvdqlykavvkadqdysktlgcnesikhttv
kpsgtvaklagasegmhfhygayliqrirfqdsdpllpalkacgyrteadiytenttcve
fpikavgadnpnfasagtvsiaeqfatqaflqtywsdnavsctitfqdsegdqvesllrq
yrfitkstsllpyfggslqqapkepidketyekrsqeitgnveevfsqlnsdvkdle

SCOPe Domain Coordinates for d1l1la_:

Click to download the PDB-style file with coordinates for d1l1la_.
(The format of our PDB-style files is described here.)

Timeline for d1l1la_: