SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1l1ia_ (1l1i A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069375Superfamily b.80.2: Insect cysteine-rich antifreeze protein [51156] (1 family) (S)
    superhelix turns are made of two short strands each
  5. 2069376Family b.80.2.1: Insect cysteine-rich antifreeze protein [51157] (1 protein)
  6. 2069377Protein Insect cysteine-rich antifreeze protein [51158] (1 species)
  7. 2069378Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [51159] (2 PDB entries)
  8. 2069381Domain d1l1ia_: 1l1i A: [73469]

Details for d1l1ia_

PDB Entry: 1l1i (more details)

PDB Description: Solution Structure of the Tenebrio molitor Antifreeze Protein
PDB Compounds: (A:) Thermal hysteresis protein isoform YL-1 (2-14)

SCOPe Domain Sequences for d1l1ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1ia_ b.80.2.1 (A:) Insect cysteine-rich antifreeze protein {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]}
qctggadctsctgactgcgncpnavtctnsqhcvkantctgstdcntaqtctnskdcfea
ntctdstncykatactnssgcpgh

SCOPe Domain Coordinates for d1l1ia_:

Click to download the PDB-style file with coordinates for d1l1ia_.
(The format of our PDB-style files is described here.)

Timeline for d1l1ia_: