Lineage for d1l1ga_ (1l1g A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167950Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)
  6. 168092Protein Elastase [50536] (4 species)
  7. 168102Species Pig (Sus scrofa) [TaxId:9823] [50538] (54 PDB entries)
  8. 168107Domain d1l1ga_: 1l1g A: [73468]

Details for d1l1ga_

PDB Entry: 1l1g (more details), 1.5 Å

PDB Description: The Structure of Porcine Pancreatic Elastase Complexed with Xenon and Bromide, Cryoprotected with Glycerol
PDB Compounds: (A:)

SCOP Domain Sequences for d1l1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1ga_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d1l1ga_:

Click to download the PDB-style file with coordinates for d1l1ga_.
(The format of our PDB-style files is described here.)

Timeline for d1l1ga_: