Lineage for d1l1ga_ (1l1g A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins) 
Protein Elastase [50536] (4 species) Species Pig (Sus scrofa) [TaxId:9823] [50538] (54 PDB entries) 
Domain d1l1ga_: 1l1g A: [73468]
Details for d1l1ga_
PDB Entry: 1l1g (more details), 1.5 Å
PDB Description: The Structure of Porcine Pancreatic Elastase Complexed with Xenon and Bromide, Cryoprotected with Glycerol
PDB Compounds: (A:) SCOP Domain Sequences for d1l1ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1ga_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
SCOP Domain Coordinates for d1l1ga_:
Click to download the PDB-style file with coordinates for d1l1ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l1ga_:
- d1l1ga_ appears in SCOP 1.63
- d1l1ga_ appears in the current release, SCOPe 2.07
View in 3D