Lineage for d1l1ff1 (1l1f F:213-505)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175982Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 protein domains)
  6. 175983Protein Glutamate dehydrogenase [51884] (7 species)
  7. 176028Species Human (Homo sapiens) [TaxId:9606] [75115] (1 PDB entry)
  8. 176034Domain d1l1ff1: 1l1f F:213-505 [73466]
    Other proteins in same PDB: d1l1fa2, d1l1fb2, d1l1fc2, d1l1fd2, d1l1fe2, d1l1ff2

Details for d1l1ff1

PDB Entry: 1l1f (more details), 2.7 Å

PDB Description: Structure of human glutamate dehydrogenase-apo form

SCOP Domain Sequences for d1l1ff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1ff1 c.2.1.7 (F:213-505) Glutamate dehydrogenase {Human (Homo sapiens)}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga
kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsileadcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfkvyneagvtft

SCOP Domain Coordinates for d1l1ff1:

Click to download the PDB-style file with coordinates for d1l1ff1.
(The format of our PDB-style files is described here.)

Timeline for d1l1ff1: