![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Glutamate dehydrogenase [51884] (8 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75115] (2 PDB entries) |
![]() | Domain d1l1fd1: 1l1f D:213-505 [73462] Other proteins in same PDB: d1l1fa2, d1l1fb2, d1l1fc2, d1l1fd2, d1l1fe2, d1l1ff2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1l1f (more details), 2.7 Å
SCOPe Domain Sequences for d1l1fd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1fd1 c.2.1.7 (D:213-505) Glutamate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsileadcdilipaase kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfkvyneagvtft
Timeline for d1l1fd1: