SCOP 1.65: Domain d1l1fc2: 1l1f C:10-212

Lineage for d1l1fc2 (1l1f C:10-212)

Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
Protein Glutamate dehydrogenase [53225] (7 species)
Species Human (Homo sapiens) [TaxId:9606] [75252] (2 PDB entries)
Domain d1l1fc2: 1l1f C:10-212 [73461]
Other proteins in same PDB: d1l1fa1, d1l1fb1, d1l1fc1, d1l1fd1, d1l1fe1, d1l1ff1

Details for d1l1fc2

PDB Entry: 1l1f (more details), 2.7 Å

PDB Description: Structure of human glutamate dehydrogenase-apo form

SCOP Domain Sequences for d1l1fc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1fc2 c.58.1.1 (C:10-212) Glutamate dehydrogenase {Human (Homo sapiens)}
dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
tighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1l1fc2:

Click to download the PDB-style file with coordinates for d1l1fc2.
(The format of our PDB-style files is described here.)

Timeline for d1l1fc2: