Lineage for d1l1da_ (1l1d A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810140Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 1810141Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 1810172Family b.88.1.3: SelR domain [75041] (3 proteins)
    automatically mapped to Pfam PF01641
  6. 1810173Protein C-terminal MsrB domain of peptide methionine sulfoxide reductase PilB [75042] (1 species)
  7. 1810174Species Neisseria gonorrhoeae [TaxId:485] [75043] (1 PDB entry)
  8. 1810175Domain d1l1da_: 1l1d A: [73452]
    complexed with cac

Details for d1l1da_

PDB Entry: 1l1d (more details), 1.85 Å

PDB Description: Crystal structure of the C-terminal methionine sulfoxide reductase domain (MsrB) of N. gonorrhoeae pilB
PDB Compounds: (A:) peptide methionine sulfoxide reductase

SCOPe Domain Sequences for d1l1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1da_ b.88.1.3 (A:) C-terminal MsrB domain of peptide methionine sulfoxide reductase PilB {Neisseria gonorrhoeae [TaxId: 485]}
ykkpsdaelkrtlteeqyqvtqnsateyafsheydhlfkpgiyvdvvsgeplfssadkyd
sgcgwpsftrpidaksvtehddfsfnmrrtevrsraadshlghvfpdgprdkgglrycin
gaslkfipleqmdaagygalkgev

SCOPe Domain Coordinates for d1l1da_:

Click to download the PDB-style file with coordinates for d1l1da_.
(The format of our PDB-style files is described here.)

Timeline for d1l1da_: