Class b: All beta proteins [48724] (176 folds) |
Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
Superfamily b.88.1: Mss4-like [51316] (5 families) duplication: tandem repeat of two similar structural motifs |
Family b.88.1.3: SelR domain [75041] (3 proteins) automatically mapped to Pfam PF01641 |
Protein C-terminal MsrB domain of peptide methionine sulfoxide reductase PilB [75042] (1 species) |
Species Neisseria gonorrhoeae [TaxId:485] [75043] (1 PDB entry) |
Domain d1l1da_: 1l1d A: [73452] complexed with cac |
PDB Entry: 1l1d (more details), 1.85 Å
SCOPe Domain Sequences for d1l1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1da_ b.88.1.3 (A:) C-terminal MsrB domain of peptide methionine sulfoxide reductase PilB {Neisseria gonorrhoeae [TaxId: 485]} ykkpsdaelkrtlteeqyqvtqnsateyafsheydhlfkpgiyvdvvsgeplfssadkyd sgcgwpsftrpidaksvtehddfsfnmrrtevrsraadshlghvfpdgprdkgglrycin gaslkfipleqmdaagygalkgev
Timeline for d1l1da_: