Lineage for d1l0yd1 (1l0y D:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059173Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 2059174Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
    Uniprot P08095
  8. 2059180Domain d1l0yd1: 1l0y D:1-107 [73446]
    Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb2, d1l0yc1, d1l0yc2, d1l0yd2
    complexed with gol, zn

Details for d1l0yd1

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc
PDB Compounds: (D:) exotoxin type a

SCOPe Domain Sequences for d1l0yd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0yd1 b.40.2.2 (D:1-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhe

SCOPe Domain Coordinates for d1l0yd1:

Click to download the PDB-style file with coordinates for d1l0yd1.
(The format of our PDB-style files is described here.)

Timeline for d1l0yd1: