SCOP 1.61: Domain d1l0yd1: 1l0y D:1-107

Lineage for d1l0yd1 (1l0y D:1-107)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)

8. Domain d1l0yd1: 1l0y D:1-107 [73446]
   Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb2, d1l0yc1, d1l0yc2, d1l0yd2

Details for d1l0yd1

PDB Entry: 1l0y, 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc

SCOP Domain Sequences for d1l0yd1:

Sequence; same for both SEQRES and ATOM records:

>d1l0yd1 b.40.2.2 (D:1-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhe

Timeline for d1l0yd1:

• d1l0yd1 is new in SCOP 1.61
  
• d1l0yd1 appears in SCOP 1.63
  
• d1l0yd1 appears in the current release, SCOPe 2.08