Lineage for d1l0yc2 (1l0y C:118-244)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361044Protein T-cell antigen receptor [49125] (7 species)
  7. 2361169Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 2361178Domain d1l0yc2: 1l0y C:118-244 [73445]
    Other proteins in same PDB: d1l0ya1, d1l0yb1, d1l0yb2, d1l0yc1, d1l0yd1, d1l0yd2
    complexed with gol, zn

Details for d1l0yc2

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc
PDB Compounds: (C:) 14.3.d T cell receptor beta chain

SCOPe Domain Sequences for d1l0yc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0yc2 b.1.1.2 (C:118-244) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgr

SCOPe Domain Coordinates for d1l0yc2:

Click to download the PDB-style file with coordinates for d1l0yc2.
(The format of our PDB-style files is described here.)

Timeline for d1l0yc2: