Lineage for d1l0yc2 (1l0y C:118-244)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 160265Protein T-cell antigen receptor [49125] (6 species)
  7. 160303Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (10 PDB entries)
  8. 160309Domain d1l0yc2: 1l0y C:118-244 [73445]
    Other proteins in same PDB: d1l0ya1, d1l0yb1, d1l0yb2, d1l0yc1, d1l0yd1, d1l0yd2

Details for d1l0yc2

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc

SCOP Domain Sequences for d1l0yc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0yc2 b.1.1.2 (C:118-244) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgr

SCOP Domain Coordinates for d1l0yc2:

Click to download the PDB-style file with coordinates for d1l0yc2.
(The format of our PDB-style files is described here.)

Timeline for d1l0yc2: