SCOPe 2.01: Domain d1l0yc1: 1l0y C:3-117

Lineage for d1l0yc1 (1l0y C:3-117)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries)
Domain d1l0yc1: 1l0y C:3-117 [73444]
Other proteins in same PDB: d1l0ya2, d1l0yb1, d1l0yb2, d1l0yc2, d1l0yd1, d1l0yd2
complexed with gol, zn

Details for d1l0yc1

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc

PDB Compounds: (C:) 14.3.d T cell receptor beta chain

SCOPe Domain Sequences for d1l0yc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0yc1 b.1.1.1 (C:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle

SCOPe Domain Coordinates for d1l0yc1:

Click to download the PDB-style file with coordinates for d1l0yc1.
(The format of our PDB-style files is described here.)

Timeline for d1l0yc1: