SCOP 1.61: Domain d1l0yc1: 1l0y C:3-117

Lineage for d1l0yc1 (1l0y C:3-117)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (15 PDB entries)

8. Domain d1l0yc1: 1l0y C:3-117 [73444]
   Other proteins in same PDB: d1l0ya2, d1l0yb1, d1l0yb2, d1l0yc2, d1l0yd1, d1l0yd2

Details for d1l0yc1

PDB Entry: 1l0y, 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc

SCOP Domain Sequences for d1l0yc1:

Sequence; same for both SEQRES and ATOM records:

>d1l0yc1 b.1.1.1 (C:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle

Timeline for d1l0yc1:

• d1l0yc1 is new in SCOP 1.61
  
• d1l0yc1 appears in SCOP 1.63
  
• d1l0yc1 appears in the current release, SCOPe 2.08