Lineage for d1l0yb2 (1l0y B:108-220)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325763Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 325764Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 325819Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 325820Species Streptococcus pyogenes [TaxId:1314] [54357] (7 PDB entries)
  8. 325829Domain d1l0yb2: 1l0y B:108-220 [73443]
    Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb1, d1l0yc1, d1l0yc2, d1l0yd1

Details for d1l0yb2

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc

SCOP Domain Sequences for d1l0yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0yb2 d.15.6.1 (B:108-220) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievyltt

SCOP Domain Coordinates for d1l0yb2:

Click to download the PDB-style file with coordinates for d1l0yb2.
(The format of our PDB-style files is described here.)

Timeline for d1l0yb2: