Lineage for d1l0ya1 (1l0y A:3-117)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289755Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1289902Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (29 PDB entries)
  8. 1289911Domain d1l0ya1: 1l0y A:3-117 [73440]
    Other proteins in same PDB: d1l0ya2, d1l0yb1, d1l0yb2, d1l0yc2, d1l0yd1, d1l0yd2
    complexed with gol, zn

Details for d1l0ya1

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc
PDB Compounds: (A:) 14.3.d T cell receptor beta chain

SCOPe Domain Sequences for d1l0ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0ya1 b.1.1.1 (A:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle

SCOPe Domain Coordinates for d1l0ya1:

Click to download the PDB-style file with coordinates for d1l0ya1.
(The format of our PDB-style files is described here.)

Timeline for d1l0ya1: