SCOP 1.63: Domain d1l0xc2: 1l0x C:118-244

Lineage for d1l0xc2 (1l0x C:118-244)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein T-cell antigen receptor [49125] (6 species)
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (10 PDB entries)
Domain d1l0xc2: 1l0x C:118-244 [73437]
Other proteins in same PDB: d1l0xa1, d1l0xb1, d1l0xb2, d1l0xc1, d1l0xd1, d1l0xd2
complexed with cry; mutant

Details for d1l0xc2

PDB Entry: 1l0x (more details), 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea

SCOP Domain Sequences for d1l0xc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0xc2 b.1.1.2 (C:118-244) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgr

SCOP Domain Coordinates for d1l0xc2:

Click to download the PDB-style file with coordinates for d1l0xc2.
(The format of our PDB-style files is described here.)

Timeline for d1l0xc2: