SCOP 1.71: Domain d1l0xc1: 1l0x C:3-117

Lineage for d1l0xc1 (1l0x C:3-117)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (17 PDB entries)

8. Domain d1l0xc1: 1l0x C:3-117 [73436]
   Other proteins in same PDB: d1l0xa2, d1l0xb1, d1l0xb2, d1l0xc2, d1l0xd1, d1l0xd2
   complexed with cry; mutant

Details for d1l0xc1

PDB Entry: 1l0x, 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea

SCOP Domain Sequences for d1l0xc1:

Sequence; same for both SEQRES and ATOM records:

>d1l0xc1 b.1.1.1 (C:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle

Timeline for d1l0xc1:

• d1l0xc1 first appeared in SCOP 1.61
  
• d1l0xc1 appears in SCOP 1.69
  
• d1l0xc1 appears in SCOP 1.73
  
• d1l0xc1 appears in the current release, SCOPe 2.08