Lineage for d1l0xc1 (1l0x C:3-117)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 364249Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 364315Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (17 PDB entries)
  8. 364329Domain d1l0xc1: 1l0x C:3-117 [73436]
    Other proteins in same PDB: d1l0xa2, d1l0xb1, d1l0xb2, d1l0xc2, d1l0xd1, d1l0xd2
    complexed with cry; mutant

Details for d1l0xc1

PDB Entry: 1l0x (more details), 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea

SCOP Domain Sequences for d1l0xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0xc1 b.1.1.1 (C:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle

SCOP Domain Coordinates for d1l0xc1:

Click to download the PDB-style file with coordinates for d1l0xc1.
(The format of our PDB-style files is described here.)

Timeline for d1l0xc1: