Lineage for d1l0xc1 (1l0x C:3-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2742041Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
  8. 2742061Domain d1l0xc1: 1l0x C:3-117 [73436]
    Other proteins in same PDB: d1l0xa2, d1l0xb1, d1l0xb2, d1l0xc2, d1l0xd1, d1l0xd2
    complexed with gol

Details for d1l0xc1

PDB Entry: 1l0x (more details), 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea
PDB Compounds: (C:) 14.3.d T cell receptor beta chain

SCOPe Domain Sequences for d1l0xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0xc1 b.1.1.1 (C:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle

SCOPe Domain Coordinates for d1l0xc1:

Click to download the PDB-style file with coordinates for d1l0xc1.
(The format of our PDB-style files is described here.)

Timeline for d1l0xc1: