| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
| Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species) |
| Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries) Uniprot P08095 |
| Domain d1l0xb2: 1l0x B:108-221 [73435] Other proteins in same PDB: d1l0xa1, d1l0xa2, d1l0xb1, d1l0xc1, d1l0xc2, d1l0xd1 complexed with gol |
PDB Entry: 1l0x (more details), 2.8 Å
SCOPe Domain Sequences for d1l0xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0xb2 d.15.6.1 (B:108-221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk
Timeline for d1l0xb2: