Lineage for d1l0xb2 (1l0x B:108-221)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018752Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1018753Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1018823Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 1018824Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
    Uniprot P08095
  8. 1018843Domain d1l0xb2: 1l0x B:108-221 [73435]
    Other proteins in same PDB: d1l0xa1, d1l0xa2, d1l0xb1, d1l0xc1, d1l0xc2, d1l0xd1
    complexed with gol

Details for d1l0xb2

PDB Entry: 1l0x (more details), 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea
PDB Compounds: (B:) exotoxin type a

SCOPe Domain Sequences for d1l0xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0xb2 d.15.6.1 (B:108-221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk

SCOPe Domain Coordinates for d1l0xb2:

Click to download the PDB-style file with coordinates for d1l0xb2.
(The format of our PDB-style files is described here.)

Timeline for d1l0xb2: