SCOP 1.73: Domain d1l0xb2: 1l0x B:108-221

Lineage for d1l0xb2 (1l0x B:108-221)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)

8. Domain d1l0xb2: 1l0x B:108-221 [73435]
   Other proteins in same PDB: d1l0xa1, d1l0xa2, d1l0xb1, d1l0xc1, d1l0xc2, d1l0xd1

Details for d1l0xb2

PDB Entry: 1l0x, 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea

PDB Compounds: (B:) exotoxin type a

SCOP Domain Sequences for d1l0xb2:

Sequence; same for both SEQRES and ATOM records:

>d1l0xb2 d.15.6.1 (B:108-221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk

Timeline for d1l0xb2:

• d1l0xb2 first appeared in SCOP 1.61
  
• d1l0xb2 appears in SCOP 1.71
  
• d1l0xb2 appears in SCOP 1.75
  
• d1l0xb2 appears in the current release, SCOPe 2.08