Lineage for d1l0xb1 (1l0x B:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667804Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 667871Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 667872Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
  8. 667891Domain d1l0xb1: 1l0x B:1-107 [73434]
    Other proteins in same PDB: d1l0xa1, d1l0xa2, d1l0xb2, d1l0xc1, d1l0xc2, d1l0xd2

Details for d1l0xb1

PDB Entry: 1l0x (more details), 2.8 Å

PDB Description: TCR beta chain complexed with streptococcal superantigen SpeA
PDB Compounds: (B:) exotoxin type a

SCOP Domain Sequences for d1l0xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0xb1 b.40.2.2 (B:1-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhe

SCOP Domain Coordinates for d1l0xb1:

Click to download the PDB-style file with coordinates for d1l0xb1.
(The format of our PDB-style files is described here.)

Timeline for d1l0xb1: