SCOP 1.69: Domain d1l0xb1: 1l0x B:1-107

Lineage for d1l0xb1 (1l0x B:1-107)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)

8. Domain d1l0xb1: 1l0x B:1-107 [73434]
   Other proteins in same PDB: d1l0xa1, d1l0xa2, d1l0xb2, d1l0xc1, d1l0xc2, d1l0xd2

Details for d1l0xb1

PDB Entry: 1l0x, 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea

SCOP Domain Sequences for d1l0xb1:

Sequence; same for both SEQRES and ATOM records:

>d1l0xb1 b.40.2.2 (B:1-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhe

Timeline for d1l0xb1:

• d1l0xb1 first appeared in SCOP 1.61
  
• d1l0xb1 appears in SCOP 1.67
  
• d1l0xb1 appears in SCOP 1.71
  
• d1l0xb1 appears in the current release, SCOPe 2.08