| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries) |
| Domain d1l0xa1: 1l0x A:3-117 [73432] Other proteins in same PDB: d1l0xa2, d1l0xb1, d1l0xb2, d1l0xc2, d1l0xd1, d1l0xd2 complexed with gol |
PDB Entry: 1l0x (more details), 2.8 Å
SCOPe Domain Sequences for d1l0xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0xa1 b.1.1.1 (A:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle
Timeline for d1l0xa1: