Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins) |
Protein Aspartyl-tRNA synthetase (AspRS) [55696] (4 species) |
Species Thermus thermophilus [TaxId:274] [55700] (3 PDB entries) |
Domain d1l0wb3: 1l0w B:1105-1294,B:1415-1580 [73431] Other proteins in same PDB: d1l0wa1, d1l0wa2, d1l0wb1, d1l0wb2 |
PDB Entry: 1l0w (more details), 2.01 Å
SCOP Domain Sequences for d1l0wb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0wb3 d.104.1.1 (B:1105-1294,B:1415-1580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus} tppfpvdagwrgeeekeaseelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfv qvetpfltkstpegardflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrd edlradrqpdftqldlemsfvevedvlelnerlmahvfrealgvelplpfprlsyeeame rygsdkpdlrXregfrflwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrv ralaydlvlngvevgggsirihdprlqarvfrllgigeeeqrekfgfflealeygapphg giawgldrllalmtgspsireviafpknkegkdpltgapspvpeeqlrelglmvvrp
Timeline for d1l0wb3: