Lineage for d1l0wb2 (1l0w B:1295-1414)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200525Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2200809Superfamily d.74.4: GAD domain-like [55261] (2 families) (S)
  5. 2200810Family d.74.4.1: GAD domain [55262] (2 proteins)
    has additional structures inserted in the common fold loops
  6. 2200818Protein Prokaryotic AspRS, insert domain [55263] (2 species)
  7. 2200826Species Thermus thermophilus, AspRS-1 [TaxId:274] [55265] (3 PDB entries)
  8. 2200828Domain d1l0wb2: 1l0w B:1295-1414 [73430]
    Other proteins in same PDB: d1l0wa1, d1l0wa3, d1l0wb1, d1l0wb3

Details for d1l0wb2

PDB Entry: 1l0w (more details), 2.01 Å

PDB Description: Aspartyl-tRNA synthetase-1 from space-grown crystals
PDB Compounds: (B:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1l0wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0wb2 d.74.4.1 (B:1295-1414) Prokaryotic AspRS, insert domain {Thermus thermophilus, AspRS-1 [TaxId: 274]}
fglelkevgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarv
eeggfsggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglk

SCOPe Domain Coordinates for d1l0wb2:

Click to download the PDB-style file with coordinates for d1l0wb2.
(The format of our PDB-style files is described here.)

Timeline for d1l0wb2: