![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.4: GAD domain-like [55261] (2 families) ![]() |
![]() | Family d.74.4.1: GAD domain [55262] (2 proteins) has additional structures inserted in the common fold loops |
![]() | Protein Prokaryotic AspRS, insert domain [55263] (2 species) |
![]() | Species Thermus thermophilus, AspRS-1 [TaxId:274] [55265] (3 PDB entries) |
![]() | Domain d1l0wb2: 1l0w B:1295-1414 [73430] Other proteins in same PDB: d1l0wa1, d1l0wa3, d1l0wb1, d1l0wb3 |
PDB Entry: 1l0w (more details), 2.01 Å
SCOPe Domain Sequences for d1l0wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0wb2 d.74.4.1 (B:1295-1414) Prokaryotic AspRS, insert domain {Thermus thermophilus, AspRS-1 [TaxId: 274]} fglelkevgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarv eeggfsggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglk
Timeline for d1l0wb2: