Lineage for d1l0wb1 (1l0w B:1001-1104)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166762Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 166763Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
  6. 166764Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)
  7. 166781Species Thermus thermophilus [TaxId:274] [50255] (3 PDB entries)
  8. 166785Domain d1l0wb1: 1l0w B:1001-1104 [73429]
    Other proteins in same PDB: d1l0wa2, d1l0wa3, d1l0wb2, d1l0wb3

Details for d1l0wb1

PDB Entry: 1l0w (more details), 2.01 Å

PDB Description: Aspartyl-tRNA synthetase-1 from space-grown crystals

SCOP Domain Sequences for d1l0wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0wb1 b.40.4.1 (B:1001-1104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus}
mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak

SCOP Domain Coordinates for d1l0wb1:

Click to download the PDB-style file with coordinates for d1l0wb1.
(The format of our PDB-style files is described here.)

Timeline for d1l0wb1: