Lineage for d1l0wa1 (1l0w A:1-104)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124636Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1124637Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. 1124654Species Thermus thermophilus, AspRS-1 [TaxId:274] [50255] (3 PDB entries)
  8. 1124655Domain d1l0wa1: 1l0w A:1-104 [73426]
    Other proteins in same PDB: d1l0wa2, d1l0wa3, d1l0wb2, d1l0wb3

Details for d1l0wa1

PDB Entry: 1l0w (more details), 2.01 Å

PDB Description: Aspartyl-tRNA synthetase-1 from space-grown crystals
PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1l0wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]}
mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak

SCOPe Domain Coordinates for d1l0wa1:

Click to download the PDB-style file with coordinates for d1l0wa1.
(The format of our PDB-style files is described here.)

Timeline for d1l0wa1: