SCOP 1.61: Domain d1l0wa1: 1l0w A:1-104

Lineage for d1l0wa1 (1l0w A:1-104)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)

7. Species Thermus thermophilus [TaxId:274] [50255] (3 PDB entries)

8. Domain d1l0wa1: 1l0w A:1-104 [73426]
   Other proteins in same PDB: d1l0wa2, d1l0wa3, d1l0wb2, d1l0wb3

Details for d1l0wa1

PDB Entry: 1l0w, 2.01 Å

PDB Description: Aspartyl-tRNA synthetase-1 from space-grown crystals

SCOP Domain Sequences for d1l0wa1:

Sequence; same for both SEQRES and ATOM records:

>d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus}
mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak

Timeline for d1l0wa1:

• d1l0wa1 is new in SCOP 1.61
  
• d1l0wa1 appears in SCOP 1.63
  
• d1l0wa1 appears in the current release, SCOPe 2.08