Lineage for d1l0vm1 (1l0v M:443-576)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 150700Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 150734Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase C-terminal domain [46977] (1 family) (S)
  5. 150735Family a.7.3.1: Succinate dehydrogenase/fumarate reductase C-terminal domain [46978] (3 proteins)
  6. 150742Protein Fumarate reductase flavoprotein subunit [46981] (2 species)
  7. 150743Species Escherichia coli [TaxId:562] [46982] (3 PDB entries)
  8. 150747Domain d1l0vm1: 1l0v M:443-576 [73419]
    Other proteins in same PDB: d1l0va2, d1l0va3, d1l0vb1, d1l0vb2, d1l0vc_, d1l0vd_, d1l0vm2, d1l0vm3, d1l0vn1, d1l0vn2, d1l0vo_, d1l0vp_

Details for d1l0vm1

PDB Entry: 1l0v (more details), 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules

SCOP Domain Sequences for d1l0vm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0vm1 a.7.3.1 (M:443-576) Fumarate reductase flavoprotein subunit {Escherichia coli}
dggenwakirdemglameegcgiyrtpelmqktidklaelqerfkrvritdtssvfntdl
lytielghglnvaecmahsamarkesrgahqrldegcterddvnflkhtlafrdadgttr
leysdvkittlppa

SCOP Domain Coordinates for d1l0vm1:

Click to download the PDB-style file with coordinates for d1l0vm1.
(The format of our PDB-style files is described here.)

Timeline for d1l0vm1: