SCOP 1.71: Domain d1l0vb1: 1l0v B:106-243

Lineage for d1l0vb1 (1l0v B:106-243)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)

6. Protein Fumarate reductase [46550] (2 species)

7. Species Escherichia coli [TaxId:562] [46551] (3 PDB entries)

8. Domain d1l0vb1: 1l0v B:106-243 [73415]
   Other proteins in same PDB: d1l0va1, d1l0va2, d1l0va3, d1l0vb2, d1l0vc_, d1l0vd_, d1l0vm1, d1l0vm2, d1l0vm3, d1l0vn2, d1l0vo_, d1l0vp_

Details for d1l0vb1

PDB Entry: 1l0v, 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules

SCOP Domain Sequences for d1l0vb1:

Sequence; same for both SEQRES and ATOM records:

>d1l0vb1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

Timeline for d1l0vb1:

• d1l0vb1 first appeared in SCOP 1.61
  
• d1l0vb1 appears in SCOP 1.69
  
• d1l0vb1 appears in SCOP 1.73
  
• d1l0vb1 appears in the current release, SCOPe 2.08