Lineage for d1l0va2 (1l0v A:0-225,A:358-442)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1351449Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1351450Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1351868Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 1351907Protein Fumarate reductase [51937] (2 species)
  7. 1351908Species Escherichia coli [TaxId:562] [51938] (5 PDB entries)
  8. 1351911Domain d1l0va2: 1l0v A:0-225,A:358-442 [73413]
    Other proteins in same PDB: d1l0va1, d1l0va3, d1l0vb1, d1l0vb2, d1l0vc_, d1l0vd_, d1l0vm1, d1l0vm3, d1l0vn1, d1l0vn2, d1l0vo_, d1l0vp_
    complexed with ce1, f3s, fad, fes, mq7, oaa, sf4

Details for d1l0va2

PDB Entry: 1l0v (more details), 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1l0va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0va2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]}
mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdXmggietdqncetr
ikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagngneaaieaqaa
gveqrlkdlvnq

SCOPe Domain Coordinates for d1l0va2:

Click to download the PDB-style file with coordinates for d1l0va2.
(The format of our PDB-style files is described here.)

Timeline for d1l0va2: