Lineage for d1l0va1 (1l0v A:443-576)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636710Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 636711Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 636718Protein Fumarate reductase [46981] (2 species)
  7. 636719Species Escherichia coli [TaxId:562] [46982] (4 PDB entries)
  8. 636722Domain d1l0va1: 1l0v A:443-576 [73412]
    Other proteins in same PDB: d1l0va2, d1l0va3, d1l0vb1, d1l0vb2, d1l0vc_, d1l0vd_, d1l0vm2, d1l0vm3, d1l0vn1, d1l0vn2, d1l0vo_, d1l0vp_

Details for d1l0va1

PDB Entry: 1l0v (more details), 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOP Domain Sequences for d1l0va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0va1 a.7.3.1 (A:443-576) Fumarate reductase {Escherichia coli [TaxId: 562]}
dggenwakirdemglameegcgiyrtpelmqktidklaelqerfkrvritdtssvfntdl
lytielghglnvaecmahsamarkesrgahqrldegcterddvnflkhtlafrdadgttr
leysdvkittlppa

SCOP Domain Coordinates for d1l0va1:

Click to download the PDB-style file with coordinates for d1l0va1.
(The format of our PDB-style files is described here.)

Timeline for d1l0va1: