SCOPe 2.06: Domain d1l0sb_: 1l0s B:

Lineage for d1l0sb_ (1l0s B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.2: An insect antifreeze protein [51177] (1 family)
   superhelical turns are made of three short strands

5. Family b.81.2.1: An insect antifreeze protein [51178] (2 proteins)
   this is a repeat family; one repeat unit is 1m8n A:50-65 found in domain

6. Protein Thermal hysteresis protein [51179] (2 species)
   there are different numbers of superhelical turns (and sequence repeats) in different isoforms

7. Species Spruce budworm (Choristoneura fumiferana), 5-turn isoforms [TaxId:7141] [88689] (3 PDB entries)

8. Domain d1l0sb_: 1l0s B: [73409]
   isoform 337
   complexed with cd

Details for d1l0sb_

PDB Entry: 1l0s, 2.3 Å

PDB Description: choristoneura fumiferana (spruce budworm) antifreeze protein isoform 337

PDB Compounds: (B:) thermal hysteresis protein

SCOPe Domain Sequences for d1l0sb_:

Sequence; same for both SEQRES and ATOM records:

>d1l0sb_ b.81.2.1 (B:) Thermal hysteresis protein {Spruce budworm (Choristoneura fumiferana), 5-turn isoforms [TaxId: 7141]}
sctntnsqlsanskcekstltncyvdksevfgttctgsrfdgvtittststgsrisgpgc
kistciitggvpapsaackisgctfsan

Timeline for d1l0sb_:

• d1l0sb_ first appeared in SCOP 1.61
  
• d1l0sb_ appears in SCOPe 2.05
  
• d1l0sb_ appears in SCOPe 2.07
  
• d1l0sb_ appears in the current release, SCOPe 2.08