Lineage for d1l0pa2 (1l0p A:1-354)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173210Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (15 proteins)
  6. 173271Protein Bacterial alpha-amylase [51447] (5 species)
  7. 173285Species Pseudoalteromonas haloplanctis (Alteromonas haloplanctis) [51449] (7 PDB entries)
  8. 173290Domain d1l0pa2: 1l0p A:1-354 [73407]
    Other proteins in same PDB: d1l0pa1

Details for d1l0pa2

PDB Entry: 1l0p (more details), 2.1 Å

PDB Description: crystal structure analysis of the complex between psychrophilic alpha amylase from pseudoalteromonas haloplanctis and nitrate

SCOP Domain Sequences for d1l0pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0pa2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanctis (Alteromonas haloplanctis)}
tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntad

SCOP Domain Coordinates for d1l0pa2:

Click to download the PDB-style file with coordinates for d1l0pa2.
(The format of our PDB-style files is described here.)

Timeline for d1l0pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l0pa1