Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Bacterial alpha-Amylase [51013] (9 species) |
Species Pseudoalteromonas haloplanktis [TaxId:228] [51015] (9 PDB entries) |
Domain d1l0pa1: 1l0p A:355-448 [73406] Other proteins in same PDB: d1l0pa2 complexed with ca, no3 |
PDB Entry: 1l0p (more details), 2.1 Å
SCOPe Domain Sequences for d1l0pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0pa1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanktis [TaxId: 228]} nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak scsgevitvnsdgtinlnigawdamaihknakln
Timeline for d1l0pa1: