Lineage for d1l0ca_ (1l0c A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2574995Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2575326Protein Serotonin N-acetyltranferase [55746] (1 species)
  7. 2575327Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries)
  8. 2575330Domain d1l0ca_: 1l0c A: [73393]
    complexed with cot

Details for d1l0ca_

PDB Entry: 1l0c (more details), 2.3 Å

PDB Description: investigation of the roles of catalytic residues in serotonin n- acetyltransferase
PDB Compounds: (A:) serotonin n-acetyltransferase

SCOPe Domain Sequences for d1l0ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0ca_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}
htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
qpavrravlmcedalvpffqrfgfhpagpcaivvgsltftemhcsl

SCOPe Domain Coordinates for d1l0ca_:

Click to download the PDB-style file with coordinates for d1l0ca_.
(The format of our PDB-style files is described here.)

Timeline for d1l0ca_: