Lineage for d1l0ba2 (1l0b A:1705-1801)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2462723Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2462724Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 2462757Family c.15.1.3: BRCT domain [63955] (1 protein)
  6. 2462758Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
    duplication: tandem repeat of BRCT domain
  7. 2462811Species Norway rat (Rattus norvegicus) [TaxId:10116] [75147] (1 PDB entry)
  8. 2462813Domain d1l0ba2: 1l0b A:1705-1801 [73392]

Details for d1l0ba2

PDB Entry: 1l0b (more details), 2.3 Å

PDB Description: Crystal Structure of rat Brca1 tandem-BRCT region
PDB Compounds: (A:) brca1

SCOPe Domain Sequences for d1l0ba2:

Sequence, based on SEQRES records: (download)

>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lfeglqiyccepftnmpkdelermlqlcgasvvkelplltrdtgahpivlvqpsawtedn
dcpdigqlckgrlvmwdwvldsisvyrcrdldaylvq

Sequence, based on observed residues (ATOM records): (download)

>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lfeglqiyccepftnmpkdelermlqlcgasvvkelplltrdtgahpivlvqrlvmwdwv
ldsisvyrcrdldaylvq

SCOPe Domain Coordinates for d1l0ba2:

Click to download the PDB-style file with coordinates for d1l0ba2.
(The format of our PDB-style files is described here.)

Timeline for d1l0ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l0ba1