Lineage for d1l0ba2 (1l0b A:1705-1801)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177256Fold c.15: BRCT domain [52112] (1 superfamily)
  4. 177257Superfamily c.15.1: BRCT domain [52113] (4 families) (S)
  5. 177270Family c.15.1.3: Breast cancer associated protein, BRCA1 [63955] (1 protein)
  6. 177271Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
  7. 177275Species Rat (Rattus norvegicus) [TaxId:10116] [75147] (1 PDB entry)
  8. 177277Domain d1l0ba2: 1l0b A:1705-1801 [73392]

Details for d1l0ba2

PDB Entry: 1l0b (more details), 2.3 Å

PDB Description: Crystal Structure of rat Brca1 tandem-BRCT region

SCOP Domain Sequences for d1l0ba2:

Sequence, based on SEQRES records: (download)

>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus)}
lfeglqiyccepftnmpkdelermlqlcgasvvkelplltrdtgahpivlvqpsawtedn
dcpdigqlckgrlvmwdwvldsisvyrcrdldaylvq

Sequence, based on observed residues (ATOM records): (download)

>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus)}
lfeglqiyccepftnmpkdelermlqlcgasvvkelplltrdtgahpivlvqrlvmwdwv
ldsisvyrcrdldaylvq

SCOP Domain Coordinates for d1l0ba2:

Click to download the PDB-style file with coordinates for d1l0ba2.
(The format of our PDB-style files is described here.)

Timeline for d1l0ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l0ba1