Lineage for d1l0ba1 (1l0b A:1591-1702)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.15: BRCT domain [52112] (1 superfamily) Superfamily c.15.1: BRCT domain [52113] (4 families) 
Family c.15.1.3: Breast cancer associated protein, BRCA1 [63955] (1 protein) Protein Breast cancer associated protein, BRCA1 [63956] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [75147] (1 PDB entry) 
Domain d1l0ba1: 1l0b A:1591-1702 [73391]
Details for d1l0ba1
PDB Entry: 1l0b (more details), 2.3 Å
PDB Description: Crystal Structure of rat Brca1 tandem-BRCT region
SCOP Domain Sequences for d1l0ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0ba1 c.15.1.3 (A:1591-1702) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus)}
raerdismvvsgltpkevmivqkfaekyrlaltdviteetthviiktdaefvcertlkyf
lgiaggkwivsyswviksiqerkllsvhefevkgdvvtgsnhqgprrsresq
SCOP Domain Coordinates for d1l0ba1:
Click to download the PDB-style file with coordinates for d1l0ba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l0ba1:
- d1l0ba1 is new in SCOP 1.61
- d1l0ba1 appears in SCOP 1.63
- d1l0ba1 appears in the current release, SCOPe 2.08
View in 3D
