Lineage for d1l0aa1 (1l0a A:350-504)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045537Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045538Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2045539Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2045605Protein TNF receptor associated factor 3 (TRAF3) [49603] (1 species)
  7. 2045606Species Human (Homo sapiens) [TaxId:9606] [49604] (5 PDB entries)
    Uniprot Q13114 377-568
  8. 2045607Domain d1l0aa1: 1l0a A:350-504 [73389]
    Other proteins in same PDB: d1l0aa2
    complexed with a TANK peptide, chain B

Details for d1l0aa1

PDB Entry: 1l0a (more details), 2.9 Å

PDB Description: downstream regulator tank binds to the cd40 recognition site on traf3
PDB Compounds: (A:) tnf receptor associated factor 3

SCOPe Domain Sequences for d1l0aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]}
yngvliwkirdykrrkqeavmgktlslysqpfytgyfgykmcarvylngdgmgkgthlsl
ffvimrgeydallpwpfkqkvtlmlmdqgssrrhlgdafkpdpnsssfkkptgemniasg
cpvfvaqtvlengtyikddtifikvivdtsdlpdp

SCOPe Domain Coordinates for d1l0aa1:

Click to download the PDB-style file with coordinates for d1l0aa1.
(The format of our PDB-style files is described here.)

Timeline for d1l0aa1: