Lineage for d1kzza1 (1kzz A:350-504)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.8: TRAF domain-like [49598] (1 superfamily) Superfamily b.8.1: TRAF domain-like [49599] (2 families) 
Family b.8.1.1: TRAF domain [49600] (3 proteins) 
Protein TNF receptor associated factor 3 (TRAF3) [49603] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49604] (4 PDB entries) 
Domain d1kzza1: 1kzz A:350-504 [73387]
Other proteins in same PDB: d1kzza2
Details for d1kzza1
PDB Entry: 1kzz (more details), 3.5 Å
PDB Description: downstream regulator tank binds to the cd40 recognition site on traf3
SCOP Domain Sequences for d1kzza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kzza1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens)}
yngvliwkirdykrrkqeavmgktlslysqpfytgyfgykmcarvylngdgmgkgthlsl
ffvimrgeydallpwpfkqkvtlmlmdqgssrrhlgdafkpdpnsssfkkptgemniasg
cpvfvaqtvlengtyikddtifikvivdtsdlpdp
SCOP Domain Coordinates for d1kzza1:
Click to download the PDB-style file with coordinates for d1kzza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kzza1:
- d1kzza1 is new in SCOP 1.61
- d1kzza1 appears in SCOP 1.63
- d1kzza1 appears in the current release, SCOPe 2.08
View in 3D
