Lineage for d1kzyb_ (1kzy B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 456653Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 456866Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 456867Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins)
  6. 456868Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 456869Species Human (Homo sapiens) [TaxId:9606] [49420] (6 PDB entries)
  8. 456880Domain d1kzyb_: 1kzy B: [73382]
    Other proteins in same PDB: d1kzyc1, d1kzyc2, d1kzyd1, d1kzyd2

Details for d1kzyb_

PDB Entry: 1kzy (more details), 2.5 Å

PDB Description: Crystal Structure of the 53bp1 BRCT Region Complexed to Tumor Suppressor P53

SCOP Domain Sequences for d1kzyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzyb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens)}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv
cacpgrdrrteeenl

SCOP Domain Coordinates for d1kzyb_:

Click to download the PDB-style file with coordinates for d1kzyb_.
(The format of our PDB-style files is described here.)

Timeline for d1kzyb_: