Lineage for d1kzqb1 (1kzq B:3-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2772780Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family) (S)
    SS-crosslinked beta-sandwich of distinct geometry but topologically similar to cupredoxins
    automatically mapped to Pfam PF04092
  5. 2772781Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (2 proteins)
  6. 2772782Protein Major surface antigen p30, SAG1 [74879] (1 species)
    duplication: tandem repeat of two homologous domains
  7. 2772783Species Toxoplasma gondii [TaxId:5811] [74880] (1 PDB entry)
  8. 2772786Domain d1kzqb1: 1kzq B:3-131 [73376]

Details for d1kzqb1

PDB Entry: 1kzq (more details), 1.7 Å

PDB Description: crystal structure of a parasite protein
PDB Compounds: (B:) Major Surface Antigen P30

SCOPe Domain Sequences for d1kzqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzqb1 b.6.2.1 (B:3-131) Major surface antigen p30, SAG1 {Toxoplasma gondii [TaxId: 5811]}
plvanqvvtcpdkkstaaviltptenhftlkcpktaltepptlayspnrqicpagttssc
tskavtlsslipeaedswwtgdsasldtagikltvpiekfpvttqtfvvgcikgddaqsc
mvtvtvqar

SCOPe Domain Coordinates for d1kzqb1:

Click to download the PDB-style file with coordinates for d1kzqb1.
(The format of our PDB-style files is described here.)

Timeline for d1kzqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kzqb2