![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family) ![]() SS-crosslinked beta-sandwich of distinct geometry but topologically similar to cupredoxins automatically mapped to Pfam PF04092 |
![]() | Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (2 proteins) |
![]() | Protein Major surface antigen p30, SAG1 [74879] (1 species) duplication: tandem repeat of two homologous domains |
![]() | Species Toxoplasma gondii [TaxId:5811] [74880] (1 PDB entry) |
![]() | Domain d1kzqa2: 1kzq A:132-255 [73375] |
PDB Entry: 1kzq (more details), 1.7 Å
SCOPe Domain Sequences for d1kzqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kzqa2 b.6.2.1 (A:132-255) Major surface antigen p30, SAG1 {Toxoplasma gondii [TaxId: 5811]} assvvnnvarcsygadstlgpvklsaegpttmtlvcgkdgvkvpqdnnqycsgttltgcn eksfkdilpkltenpwqgnassdkgatltikkeafpaesksviigctggspekhhctvkl efag
Timeline for d1kzqa2: