Lineage for d1kzqa2 (1kzq A:132-255)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 163028Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family) (S)
  5. 163029Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (1 protein)
  6. 163030Protein Major surface antigen p30, SAG1 [74879] (1 species)
  7. 163031Species Toxoplasma gondii [TaxId:5811] [74880] (1 PDB entry)
  8. 163033Domain d1kzqa2: 1kzq A:132-255 [73375]

Details for d1kzqa2

PDB Entry: 1kzq (more details), 1.7 Å

PDB Description: crystal structure of a parasite protein

SCOP Domain Sequences for d1kzqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzqa2 b.6.2.1 (A:132-255) Major surface antigen p30, SAG1 {Toxoplasma gondii}
assvvnnvarcsygadstlgpvklsaegpttmtlvcgkdgvkvpqdnnqycsgttltgcn
eksfkdilpkltenpwqgnassdkgatltikkeafpaesksviigctggspekhhctvkl
efag

SCOP Domain Coordinates for d1kzqa2:

Click to download the PDB-style file with coordinates for d1kzqa2.
(The format of our PDB-style files is described here.)

Timeline for d1kzqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kzqa1