Lineage for d1kzka_ (1kzk A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168884Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 168885Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 168886Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 168902Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 168903Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (141 PDB entries)
  8. 168904Domain d1kzka_: 1kzk A: [73371]

Details for d1kzka_

PDB Entry: 1kzk (more details), 1.09 Å

PDB Description: je-2147-hiv protease complex

SCOP Domain Sequences for d1kzka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzka_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

SCOP Domain Coordinates for d1kzka_:

Click to download the PDB-style file with coordinates for d1kzka_.
(The format of our PDB-style files is described here.)

Timeline for d1kzka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kzkb_